OsI_07667 OsI_07667 Acts as a sulfur carrier required for molybdopterin biosynthesis. Component of the molybdopterin synthase complex that catalyzes the conversion of precursor Z into molybdopterin by mediating the incorporation of 2 sulfur atoms into precursor Z to generate a dithiolene group. In the complex, serves as sulfur donor by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. After interaction with MOCS2B, the sulfur is then transferred to precursor Z to form molybdopterin (By similarity). Sulfur carrier protein MOCS2A Molybdopterin synthase sulfur carrier subunit Molybdenum cofactor synthesis protein 2 small subunit Molybdenum cofactor synthesis protein 2A MALDPKANHAAAAAASADNPTAAAAKAKVKVKVLFFARARDLTGVTEAPVEVPAGSTAGDCLARVLAAFPRLEEIRRSMVLALNEEYAPEDAAVGDGDELAIIPPISGG MOC2A_ORYSI 109